Anti-GPT2
Artikelnummer:
ATA-HPA051514
- Bilder (9)
| Artikelname: | Anti-GPT2 |
| Artikelnummer: | ATA-HPA051514 |
| Hersteller Artikelnummer: | HPA051514 |
| Alternativnummer: | ATA-HPA051514-100,ATA-HPA051514-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALT2 |
| glutamic pyruvate transaminase (alanine aminotransferase) 2 |
| Anti-GPT2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84706 |
| UniProt: | Q8TD30 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GPT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in parietal cells. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows very weak positivity in lymphoid cells. |
|
|
Western blot analysis in human cell lines Caco-2 and HeLa using Anti-GPT2 antibody. Corresponding GPT2 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA051514-100ul |
|
|
|
|
|
HPA051514-100ul |
|
|
HPA051514-100ul |
Produktgarantie und fachkundiger Support
