Anti-KCNE2
Artikelnummer:
ATA-HPA051553
- Bilder (9)
| Artikelname: | Anti-KCNE2 |
| Artikelnummer: | ATA-HPA051553 |
| Hersteller Artikelnummer: | HPA051553 |
| Alternativnummer: | ATA-HPA051553-100,ATA-HPA051553-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LQT6, MiRP1 |
| potassium voltage-gated channel, Isk-related family, member 2 |
| Anti-KCNE2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9992 |
| UniProt: | Q9Y6J6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | STVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KCNE2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human stomach and liver tissues using Anti-KCNE2 antibody. Corresponding KCNE2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, liver, stomach and testis using Anti-KCNE2 antibody HPA051553 (A) shows similar protein distribution across tissues to independent antibody HPA029706 (B). |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-KCNE2 antibody HPA051553. |
|
|
Immunohistochemical staining of human testis using Anti-KCNE2 antibody HPA051553. |
|
|
HPA051553-100ul |
|
|
HPA051553-100ul |
|
|
HPA051553-100ul |
Produktgarantie und fachkundiger Support
