Anti-RPL13

Artikelnummer: ATA-HPA051702
Artikelname: Anti-RPL13
Artikelnummer: ATA-HPA051702
Hersteller Artikelnummer: HPA051702
Alternativnummer: ATA-HPA051702-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BBC1, D16S444E, L13
ribosomal protein L13
Anti-RPL13
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 6137
UniProt: P26373
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RPL13
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli, cytosol & endoplasmic reticulum.
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPL13 antibody. Remaining relative intensity is presented.
HPA051702-100ul
HPA051702-100ul
HPA051702-100ul