Anti-CD248

Artikelnummer: ATA-HPA051856
Artikelname: Anti-CD248
Artikelnummer: ATA-HPA051856
Hersteller Artikelnummer: HPA051856
Alternativnummer: ATA-HPA051856-100,ATA-HPA051856-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD164L1, TEM1
CD248 molecule, endosialin
Anti-CD248
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 57124
UniProt: Q9HCU0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD248
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line ASC TERT1 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry analysis in human placenta and tonsil tissues using Anti-CD248 antibody. Corresponding CD248 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human tonsil shows low expression as expected.
HPA051856-100ul
HPA051856-100ul
HPA051856-100ul