Anti-PNLDC1
Artikelnummer:
ATA-HPA052026
- Bilder (7)
| Artikelname: | Anti-PNLDC1 |
| Artikelnummer: | ATA-HPA052026 |
| Hersteller Artikelnummer: | HPA052026 |
| Alternativnummer: | ATA-HPA052026-100,ATA-HPA052026-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ195P10.2, FLJ40240 |
| poly(A)-specific ribonuclease (PARN)-like domain containing 1 |
| Anti-PNLDC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 154197 |
| UniProt: | Q8NA58 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PNLDC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows weak membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows moderate membranous positivity in intercalated ducts. |
|
|
Immunohistochemical staining of human stomach shows low positivity in glandular cells as expected. |
|
|
HPA052026-100ul |
|
|
HPA052026-100ul |
|
|
HPA052026-100ul |
Produktgarantie und fachkundiger Support
