Anti-CSDE1
Artikelnummer:
ATA-HPA052221
- Bilder (9)
| Artikelname: | Anti-CSDE1 |
| Artikelnummer: | ATA-HPA052221 |
| Hersteller Artikelnummer: | HPA052221 |
| Alternativnummer: | ATA-HPA052221-100,ATA-HPA052221-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | D1S155E, UNR |
| cold shock domain containing E1, RNA-binding |
| Anti-CSDE1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7812 |
| UniProt: | O75534 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CSDE1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to cytosol. |
|
|
Immunohistochemical staining of human prostate shows strong granular positivity in cytoplasm in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows strong granular positivity in cytoplasm in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate granular positivity in cytoplasm in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows moderate granular positivity in cytoplasm in trophoblastic cells. |
|
|
|
|
|
HPA052221-100ul |
|
|
HPA052221-100ul |
|
|
HPA052221-100ul |
Produktgarantie und fachkundiger Support
