Anti-KMT5C
Artikelnummer:
ATA-HPA052294
- Bilder (9)
| Artikelname: | Anti-KMT5C |
| Artikelnummer: | ATA-HPA052294 |
| Hersteller Artikelnummer: | HPA052294 |
| Alternativnummer: | ATA-HPA052294-100,ATA-HPA052294-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC2705, SUV420H2 |
| lysine methyltransferase 5C |
| Anti-KMT5C |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84787 |
| UniProt: | Q86Y97 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KMT5C |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human cerebellum shows weak to moderate nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human liver shows very weak nuclear positivity in hepatocytes. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human upper gastrointestinal shows moderate nuclear positivity in glandular cells. |
|
|
HPA052294-100ul |
|
|
|
|
|
HPA052294-100ul |
|
|
HPA052294-100ul |
Produktgarantie und fachkundiger Support
