Anti-TRAF4
Artikelnummer:
ATA-HPA052377
- Bilder (9)
| Artikelname: | Anti-TRAF4 |
| Artikelnummer: | ATA-HPA052377 |
| Hersteller Artikelnummer: | HPA052377 |
| Alternativnummer: | ATA-HPA052377-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CART1, MLN62, RNF83 |
| TNF receptor-associated factor 4 |
| Anti-TRAF4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9618 |
| UniProt: | Q9BUZ4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TRAF4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using Anti-TRAF4 antibody. Corresponding TRAF4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human gallbladder shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell lines HeLa and PC-3 using Anti-TRAF4 antibody. Corresponding TRAF4 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA052377-100ul |
|
|
|
|
|
HPA052377-100ul |
|
|
HPA052377-100ul |
Produktgarantie und fachkundiger Support
