Anti-AFM
Artikelnummer:
ATA-HPA052437
- Bilder (8)
| Artikelname: | Anti-AFM |
| Artikelnummer: | ATA-HPA052437 |
| Hersteller Artikelnummer: | HPA052437 |
| Alternativnummer: | ATA-HPA052437-100,ATA-HPA052437-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALB2, ALBA |
| afamin |
| Anti-AFM |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 173 |
| UniProt: | P43652 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVDAQRRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | AFM |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-AFM antibody HPA052437 (A) shows similar protein distribution across tissues to independent antibody HPA017006 (B). |
|
|
Immunohistochemical staining of human liver using Anti-AFM antibody HPA052437. |
|
|
Immunohistochemical staining of human colon using Anti-AFM antibody HPA052437. |
|
|
Immunohistochemical staining of human kidney using Anti-AFM antibody HPA052437. |
|
|
Immunohistochemical staining of human lymph node using Anti-AFM antibody HPA052437. |
|
|
HPA052437-100ul |
|
|
HPA052437-100ul |
|
|
HPA052437-100ul |
Produktgarantie und fachkundiger Support
