Anti-AKR1B1
Artikelnummer:
ATA-HPA052751
- Bilder (8)
| Artikelname: | Anti-AKR1B1 |
| Artikelnummer: | ATA-HPA052751 |
| Hersteller Artikelnummer: | HPA052751 |
| Alternativnummer: | ATA-HPA052751-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALDR1, AR |
| aldo-keto reductase family 1, member B1 (aldose reductase) |
| Anti-AKR1B1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 231 |
| UniProt: | P15121 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | AKR1B1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human adrenal gland and cerebral cortex tissues using Anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA052751-100ul |
|
|
|
|
|
HPA052751-100ul |
|
|
HPA052751-100ul |
Produktgarantie und fachkundiger Support
