Anti-DNAL1
Artikelnummer:
ATA-HPA053129
- Bilder (6)
| Artikelname: | Anti-DNAL1 |
| Artikelnummer: | ATA-HPA053129 |
| Hersteller Artikelnummer: | HPA053129 |
| Alternativnummer: | ATA-HPA053129-100,ATA-HPA053129-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 1700010H15RiK, C14orf168, CILD16, MGC12435 |
| dynein, axonemal, light chain 1 |
| Anti-DNAL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 83544 |
| UniProt: | Q4LDG9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & microtubule organizing center. |
|
|
Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in astrocytes. |
|
|
HPA053129-100ul |
|
|
|
|
|
HPA053129-100ul |
|
|
HPA053129-100ul |
Produktgarantie und fachkundiger Support
