Anti-OTUD6A

Artikelnummer: ATA-HPA053304
Artikelname: Anti-OTUD6A
Artikelnummer: ATA-HPA053304
Hersteller Artikelnummer: HPA053304
Alternativnummer: ATA-HPA053304-100,ATA-HPA053304-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DUBA2, FLJ25831, HSHIN6
OTU deubiquitinase 6A
Anti-OTUD6A
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 139562
UniProt: Q7L8S5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: OTUD6A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-OTUD6A antibody. Corresponding OTUD6A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and OTUD6A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404097).
HPA053304-100ul
HPA053304-100ul
HPA053304-100ul