Anti-TJP3

Artikelnummer: ATA-HPA053337
Artikelname: Anti-TJP3
Artikelnummer: ATA-HPA053337
Hersteller Artikelnummer: HPA053337
Alternativnummer: ATA-HPA053337-100,ATA-HPA053337-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ZO-3
tight junction protein 3
Anti-TJP3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 27134
UniProt: O95049
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TJP3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions.
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-TJP3 antibody. Corresponding TJP3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA053337-100ul
HPA053337-100ul
HPA053337-100ul