Anti-KRT25
Artikelnummer:
ATA-HPA053977
- Bilder (8)
| Artikelname: | Anti-KRT25 |
| Artikelnummer: | ATA-HPA053977 |
| Hersteller Artikelnummer: | HPA053977 |
| Alternativnummer: | ATA-HPA053977-100,ATA-HPA053977-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KRT25A |
| keratin 25 |
| Anti-KRT25 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 147183 |
| UniProt: | Q7Z3Z0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KRT25 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, lymph node and skin, hairy using Anti-KRT25 antibody HPA053977 (A) shows similar protein distribution across tissues to independent antibody HPA058943 (B). |
|
|
Immunohistochemical staining of human lymph node using Anti-KRT25 antibody HPA053977. |
|
|
Immunohistochemical staining of human skin, hairy using Anti-KRT25 antibody HPA053977. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-KRT25 antibody HPA053977. |
|
|
Immunohistochemical staining of human liver using Anti-KRT25 antibody HPA053977. |
|
|
HPA053977-100ul |
|
|
HPA053977-100ul |
|
|
HPA053977-100ul |
Produktgarantie und fachkundiger Support
