Anti-CCDC93
Artikelnummer:
ATA-HPA054183
- Bilder (9)
| Artikelname: | Anti-CCDC93 |
| Artikelnummer: | ATA-HPA054183 |
| Hersteller Artikelnummer: | HPA054183 |
| Alternativnummer: | ATA-HPA054183-100,ATA-HPA054183-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10996 |
| coiled-coil domain containing 93 |
| Anti-CCDC93 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54520 |
| UniProt: | Q567U6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYSLPEDDDFIKRKEKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CCDC93 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to vesicles. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes. |
|
|
HPA054183-100ul |
|
|
|
|
|
HPA054183-100ul |
|
|
HPA054183-100ul |
Produktgarantie und fachkundiger Support
