Anti-FAM192A
Artikelnummer:
ATA-HPA054382
- Bilder (7)
| Artikelname: | Anti-FAM192A |
| Artikelnummer: | ATA-HPA054382 |
| Hersteller Artikelnummer: | HPA054382 |
| Alternativnummer: | ATA-HPA054382-100,ATA-HPA054382-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C16orf94, NIP30 |
| family with sequence similarity 192, member A |
| Anti-FAM192A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80011 |
| UniProt: | Q9GZU8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM192A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human stomach shows moderate positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line MOLT-4 |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FAM192A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403039). |
|
|
HPA054382-100ul |
|
|
HPA054382-100ul |
|
|
HPA054382-100ul |
Produktgarantie und fachkundiger Support
