Anti-SIRPA
Artikelnummer:
ATA-HPA054437
- Bilder (8)
| Artikelname: | Anti-SIRPA |
| Artikelnummer: | ATA-HPA054437 |
| Hersteller Artikelnummer: | HPA054437 |
| Alternativnummer: | ATA-HPA054437-100,ATA-HPA054437-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BIT, CD172a, MFR, MYD-1, P84, PTPNS1, SHPS-1, SHPS1, SIRP, SIRP-ALPHA-1, SIRPalpha, SIRPalpha2 |
| signal-regulatory protein alpha |
| Anti-SIRPA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 140885 |
| UniProt: | P78324 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SIRPA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-SIRPA antibody HPA054437 (A) shows similar protein distribution across tissues to independent antibody HPA058511 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-SIRPA antibody HPA054437. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SIRPA antibody HPA054437. |
|
|
Immunohistochemical staining of human colon using Anti-SIRPA antibody HPA054437. |
|
|
Immunohistochemical staining of human liver using Anti-SIRPA antibody HPA054437. |
|
|
HPA054437-100ul |
|
|
HPA054437-100ul |
|
|
HPA054437-100ul |
Produktgarantie und fachkundiger Support
