Anti-RPS23

Artikelnummer: ATA-HPA054853
Artikelname: Anti-RPS23
Artikelnummer: ATA-HPA054853
Hersteller Artikelnummer: HPA054853
Alternativnummer: ATA-HPA054853-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: S23
ribosomal protein S23
Anti-RPS23
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 6228
UniProt: P62266
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RPS23
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line HEK 293
HPA054853-100ul
HPA054853-100ul
HPA054853-100ul