Anti-SLC5A1
Artikelnummer:
ATA-HPA055106
- Bilder (8)
| Artikelname: | Anti-SLC5A1 |
| Artikelnummer: | ATA-HPA055106 |
| Hersteller Artikelnummer: | HPA055106 |
| Alternativnummer: | ATA-HPA055106-100,ATA-HPA055106-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | D22S675, NAGT, SGLT1 |
| solute carrier family 5 (sodium/glucose cotransporter), member 1 |
| Anti-SLC5A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6523 |
| UniProt: | P13866 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRAD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC5A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles. |
|
|
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-SLC5A1 antibody. Corresponding SLC5A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA055106-100ul |
|
|
|
|
|
HPA055106-100ul |
|
|
HPA055106-100ul |
Produktgarantie und fachkundiger Support
