Anti-SYNPO2L

Artikelnummer: ATA-HPA055192
Artikelname: Anti-SYNPO2L
Artikelnummer: ATA-HPA055192
Hersteller Artikelnummer: HPA055192
Alternativnummer: ATA-HPA055192-100,ATA-HPA055192-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ12921
synaptopodin 2-like
Anti-SYNPO2L
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 79933
UniProt: Q9H987
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PAEALLLPHGPLRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTIASLLTA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SYNPO2L
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles & cell junctions.
Immunohistochemistry analysis in human heart muscle and skin tissues using Anti-SYNPO2L antibody. Corresponding SYNPO2L RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
HPA055192-100ul
HPA055192-100ul
HPA055192-100ul