Anti-KRT12
Artikelnummer:
ATA-HPA055835
- Bilder (8)
| Artikelname: | Anti-KRT12 |
| Artikelnummer: | ATA-HPA055835 |
| Hersteller Artikelnummer: | HPA055835 |
| Alternativnummer: | ATA-HPA055835-100,ATA-HPA055835-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | K12 |
| keratin 12, type I |
| Anti-KRT12 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3859 |
| UniProt: | Q99456 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QGDGLEESLFVTDSKSQAQSTDSSKDPTKTRK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KRT12 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex, eye, liver and lymph node using Anti-KRT12 antibody HPA055835 (A) shows similar protein distribution across tissues to independent antibody HPA055217 (B). |
|
|
Immunohistochemical staining of human lymph node using Anti-KRT12 antibody HPA055835. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-KRT12 antibody HPA055835. |
|
|
Immunohistochemical staining of human eye using Anti-KRT12 antibody HPA055835. |
|
|
Immunohistochemical staining of human liver using Anti-KRT12 antibody HPA055835. |
|
|
HPA055835-100ul |
|
|
HPA055835-100ul |
|
|
HPA055835-100ul |
Produktgarantie und fachkundiger Support
