Anti-CASKIN1

Artikelnummer: ATA-HPA055990
Artikelname: Anti-CASKIN1
Artikelnummer: ATA-HPA055990
Hersteller Artikelnummer: HPA055990
Alternativnummer: ATA-HPA055990-100,ATA-HPA055990-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ANKS5A, KIAA1306
CASK interacting protein 1
Anti-CASKIN1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 57524
UniProt: Q8WXD9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CASKIN1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CASKIN1 antibody. Corresponding CASKIN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA055990-100ul
HPA055990-100ul
HPA055990-100ul