Anti-DNAH11
Artikelnummer:
ATA-HPA056474
- Bilder (4)
| Artikelname: | Anti-DNAH11 |
| Artikelnummer: | ATA-HPA056474 |
| Hersteller Artikelnummer: | HPA056474 |
| Alternativnummer: | ATA-HPA056474-100,ATA-HPA056474-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CILD7, DNAHBL, Dnahc11, DNHBL, DPL11 |
| dynein, axonemal, heavy chain 11 |
| Anti-DNAH11 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8701 |
| UniProt: | Q96DT5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAH11 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemical staining of human fallopian tube shows membranous positivity in glandular cells. |
|
|
HPA056474-100ul |
|
|
HPA056474-100ul |
|
|
HPA056474-100ul |
Produktgarantie und fachkundiger Support
