Anti-MIA3
Artikelnummer:
ATA-HPA056816
- Bilder (8)
| Artikelname: | Anti-MIA3 |
| Artikelnummer: | ATA-HPA056816 |
| Hersteller Artikelnummer: | HPA056816 |
| Alternativnummer: | ATA-HPA056816-100,ATA-HPA056816-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ39207, KIAA0268, TANGO, UNQ6077 |
| melanoma inhibitory activity family, member 3 |
| Anti-MIA3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 375056 |
| UniProt: | Q5JRA6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MIA3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-MIA3 antibody. Corresponding MIA3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA056816-100ul |
|
|
|
|
|
HPA056816-100ul |
|
|
HPA056816-100ul |
Produktgarantie und fachkundiger Support
