Anti-FKBP10
Artikelnummer:
ATA-HPA057021
- Bilder (8)
| Artikelname: | Anti-FKBP10 |
| Artikelnummer: | ATA-HPA057021 |
| Hersteller Artikelnummer: | HPA057021 |
| Alternativnummer: | ATA-HPA057021-100,ATA-HPA057021-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FKBP6, FLJ20683, FLJ22041, FLJ23833, hFKBP65 |
| FK506 binding protein 10, 65 kDa |
| Anti-FKBP10 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 60681 |
| UniProt: | Q96AY3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FKBP10 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human endometrium and duodenum tissues using Anti-FKBP10 antibody. Corresponding FKBP10 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows high expression. |
|
|
Immunohistochemical staining of human duodenum shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
HPA057021-100ul |
|
|
|
|
|
HPA057021-100ul |
|
|
HPA057021-100ul |
Produktgarantie und fachkundiger Support
