Anti-CSN1S1
Artikelnummer:
ATA-HPA057031
- Bilder (8)
| Artikelname: | Anti-CSN1S1 |
| Artikelnummer: | ATA-HPA057031 |
| Hersteller Artikelnummer: | HPA057031 |
| Alternativnummer: | ATA-HPA057031-100,ATA-HPA057031-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CASA, CSN1 |
| casein alpha s1 |
| Anti-CSN1S1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1446 |
| UniProt: | P47710 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CSN1S1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemical staining of human breast, cerebral cortex, kidney and liver using Anti-CSN1S1 antibody HPA057031 (A) shows similar protein distribution across tissues to independent antibody HPA035659 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CSN1S1 antibody HPA057031. |
|
|
Immunohistochemical staining of human breast using Anti-CSN1S1 antibody HPA057031. |
|
|
Immunohistochemical staining of human liver using Anti-CSN1S1 antibody HPA057031. |
|
|
Immunohistochemical staining of human kidney using Anti-CSN1S1 antibody HPA057031. |
|
|
HPA057031-100ul |
|
|
HPA057031-100ul |
|
|
HPA057031-100ul |
Produktgarantie und fachkundiger Support
