Anti-CXCL8 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA057179
Artikelname: Anti-CXCL8 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA057179
Hersteller Artikelnummer: HPA057179
Alternativnummer: ATA-HPA057179-100,ATA-HPA057179-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: 3-10C, AMCF-I, b-ENAP, GCP-1, GCP1, IL-8, IL8, K60, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1, SCYB8, TSG-1
chemokine (C-X-C motif) ligand 8

Anti-CXCL8

Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3576
UniProt: P10145
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CXCL8
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemical staining of human rectum shows moderate positivity in plasma.
Immunohistochemical staining of human placenta shows moderate positivity in plasma.
Immunohistochemical staining of human lymph node shows weak to moderate cytoplasmic positivity in a subset of non-germinal center cells.
Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected.
Western blot analysis in human cell line EFO-21.
HPA057179
HPA057179
HPA057179