Anti-WDR72
Artikelnummer:
ATA-HPA057410
- Bilder (7)
| Artikelname: | Anti-WDR72 |
| Artikelnummer: | ATA-HPA057410 |
| Hersteller Artikelnummer: | HPA057410 |
| Alternativnummer: | ATA-HPA057410-100,ATA-HPA057410-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ38736 |
| WD repeat domain 72 |
| Anti-WDR72 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 256764 |
| UniProt: | Q3MJ13 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | WDR72 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules. |
|
|
Immunohistochemical staining of human thyroid gland shows moderate to strong nuclear positivity in follicular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human salivary gland shows moderate to strong nuclear positivity in acinar cells. |
|
|
HPA057410-100ul |
|
|
HPA057410-100ul |
|
|
HPA057410-100ul |
Produktgarantie und fachkundiger Support
