Anti-STAG3
Artikelnummer:
ATA-HPA058330
- Bilder (9)
| Artikelname: | Anti-STAG3 |
| Artikelnummer: | ATA-HPA058330 |
| Hersteller Artikelnummer: | HPA058330 |
| Alternativnummer: | ATA-HPA058330-100,ATA-HPA058330-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | STAG3 |
| stromal antigen 3 |
| Anti-STAG3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10734 |
| UniProt: | Q9UJ98 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LFHQDKQLLLSYLEKCLQHVSQAPGHPWGPVTTYCHSLSPVENTAETSPQVLPSSKRRRVEGPAKPNREDVSS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | STAG3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and stomach tissues using Anti-STAG3 antibody. Corresponding STAG3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, stomach and testis using Anti-STAG3 antibody HPA058330 (A) shows similar protein distribution across tissues to independent antibody HPA049106 (B). |
|
|
Immunohistochemical staining of human stomach shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-STAG3 antibody HPA058330. |
|
|
Immunohistochemical staining of human kidney using Anti-STAG3 antibody HPA058330. |
|
|
HPA058330-100ul |
|
|
HPA058330-100ul |
|
|
HPA058330-100ul |
Produktgarantie und fachkundiger Support
