Anti-CDH2
Artikelnummer:
ATA-HPA058574
- Bilder (8)
| Artikelname: | Anti-CDH2 |
| Artikelnummer: | ATA-HPA058574 |
| Hersteller Artikelnummer: | HPA058574 |
| Alternativnummer: | ATA-HPA058574-100,ATA-HPA058574-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD325, CDHN, NCAD |
| cadherin 2, type 1, N-cadherin (neuronal) |
| Anti-CDH2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1000 |
| UniProt: | P19022 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CDH2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human heart muscle and skin tissues using HPA058574 antibody. Corresponding CDH2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skin shows no positivity in keratinocytes. |
|
|
HPA058574-100ul |
|
|
HPA058574-100ul |
|
|
HPA058574-100ul |
Produktgarantie und fachkundiger Support
