Anti-CDADC1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA058766
| Artikelname: |
Anti-CDADC1, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA058766 |
| Hersteller Artikelnummer: |
HPA058766 |
| Alternativnummer: |
ATA-HPA058766-100,ATA-HPA058766-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
NYD-SP15 |
| Rabbit Polyclonal CDADC1 Antibody against Human cytidine and dCMP deaminase domain containing 1. Validated for Western Blot |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 |
| NCBI: |
81602 |
| UniProt: |
Q9BWV3 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequenz: |
LWMELFPAEAQRQKSQKNEEGKHGPLGDNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGSRLKNCDLYFSRKPCSACLKMIVN |