Anti-RUNX3

Artikelnummer: ATA-HPA059006
Artikelname: Anti-RUNX3
Artikelnummer: ATA-HPA059006
Hersteller Artikelnummer: HPA059006
Alternativnummer: ATA-HPA059006-100,ATA-HPA059006-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AML2, CBFA3, PEBP2A3
runt-related transcription factor 3
Anti-RUNX3
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 864
UniProt: Q13761
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RUNX3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-RUNX3 antibody. Corresponding RUNX3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line SK-MEL-30
HPA059006-100ul
HPA059006-100ul
HPA059006-100ul