Anti-HGFAC
Artikelnummer:
ATA-HPA059076
- Bilder (8)
| Artikelname: | Anti-HGFAC |
| Artikelnummer: | ATA-HPA059076 |
| Hersteller Artikelnummer: | HPA059076 |
| Alternativnummer: | ATA-HPA059076-100,ATA-HPA059076-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HGFA, HGFAP |
| HGF activator |
| Anti-HGFAC |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3083 |
| UniProt: | Q04756 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SCSNTQDPQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECLGGRTWCEGTRHTACLS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HGFAC |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human colon, kidney, liver and soft tissues using Anti-HGFAC antibody HPA059076 (A) shows similar protein distribution across tissues to independent antibody HPA058279 (B). |
|
|
Immunohistochemical staining of human colon using Anti-HGFAC antibody HPA059076. |
|
|
Immunohistochemical staining of human soft tissues using Anti-HGFAC antibody HPA059076. |
|
|
Immunohistochemical staining of human kidney using Anti-HGFAC antibody HPA059076. |
|
|
Immunohistochemical staining of human liver using Anti-HGFAC antibody HPA059076. |
|
|
HPA059076-100ul |
|
|
HPA059076-100ul |
|
|
HPA059076-100ul |
Produktgarantie und fachkundiger Support
