Anti-HINT2

Artikelnummer: ATA-HPA059109
Artikelname: Anti-HINT2
Artikelnummer: ATA-HPA059109
Hersteller Artikelnummer: HPA059109
Alternativnummer: ATA-HPA059109-100,ATA-HPA059109-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HINT2
histidine triad nucleotide binding protein 2
Anti-HINT2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 84681
UniProt: Q9BX68
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HINT2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-HINT2 antibody. Corresponding HINT2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA059109-100ul
HPA059109-100ul
HPA059109-100ul