Anti-GRK1
Artikelnummer:
ATA-HPA059376
- Bilder (8)
| Artikelname: | Anti-GRK1 |
| Artikelnummer: | ATA-HPA059376 |
| Hersteller Artikelnummer: | HPA059376 |
| Alternativnummer: | ATA-HPA059376-100,ATA-HPA059376-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GPRK1, RHOK, RK |
| G protein-coupled receptor kinase 1 |
| Anti-GRK1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.7 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6011 |
| UniProt: | Q15835 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GRK1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemical staining of human colon, eye, retina, liver and lymph node using Anti-GRK1 antibody HPA059376 (A) shows similar protein distribution across tissues to independent antibody HPA035200 (B). |
|
|
Immunohistochemical staining of human liver using Anti-GRK1 antibody HPA059376. |
|
|
Immunohistochemical staining of human lymph node using Anti-GRK1 antibody HPA059376. |
|
|
Immunohistochemical staining of human eye, retina using Anti-GRK1 antibody HPA059376. |
|
|
Immunohistochemical staining of human colon using Anti-GRK1 antibody HPA059376. |
|
|
HPA059376-100ul |
|
|
HPA059376-100ul |
|
|
HPA059376-100ul |
Produktgarantie und fachkundiger Support
