Anti-CEACAM18
Artikelnummer:
ATA-HPA059487
- Bilder (7)
| Artikelname: | Anti-CEACAM18 |
| Artikelnummer: | ATA-HPA059487 |
| Hersteller Artikelnummer: | HPA059487 |
| Alternativnummer: | ATA-HPA059487-100,ATA-HPA059487-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CEACAM18 |
| carcinoembryonic antigen-related cell adhesion molecule 18 |
| Anti-CEACAM18 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | None |
| UniProt: | A8MTB9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CEACAM18 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to midbody. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA059487-100ul |
|
|
|
|
|
HPA059487-100ul |
|
|
HPA059487-100ul |
Produktgarantie und fachkundiger Support
