Anti-NUP133
Artikelnummer:
ATA-HPA059767
- Bilder (8)
| Artikelname: | Anti-NUP133 |
| Artikelnummer: | ATA-HPA059767 |
| Hersteller Artikelnummer: | HPA059767 |
| Alternativnummer: | ATA-HPA059767-100,ATA-HPA059767-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10814 |
| nucleoporin 133kDa |
| Anti-NUP133 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55746 |
| UniProt: | Q8WUM0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVRGTPMATRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NUP133 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to nuclear membrane. |
|
|
Immunohistochemical staining of human cerebellum shows strong nuclear membranous positivity in Purkinje cells. |
|
|
Western blot analysis in human cell line RT-4 and human cell line U-251 MG. |
|
|
|
|
|
HPA059767-100ul |
|
|
|
|
|
HPA059767-100ul |
|
|
HPA059767-100ul |
Produktgarantie und fachkundiger Support
