Anti-BPIFB2
Artikelnummer:
ATA-HPA060121
- Bilder (9)
| Artikelname: | Anti-BPIFB2 |
| Artikelnummer: | ATA-HPA060121 |
| Hersteller Artikelnummer: | HPA060121 |
| Alternativnummer: | ATA-HPA060121-100,ATA-HPA060121-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BPIL1, C20orf184, dJ726C3.2, LPLUNC2 |
| BPI fold containing family B, member 2 |
| Anti-BPIFB2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80341 |
| UniProt: | Q8N4F0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BPIFB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human salivary gland and liver tissues using Anti-BPIFB2 antibody. Corresponding BPIFB2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, kidney, liver and salivary gland using Anti-BPIFB2 antibody HPA060121 (A) shows similar protein distribution across tissues to independent antibody HPA049491 (B). |
|
|
Immunohistochemical staining of human salivary gland shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human colon using Anti-BPIFB2 antibody HPA060121. |
|
|
Immunohistochemical staining of human kidney using Anti-BPIFB2 antibody HPA060121. |
|
|
HPA060121-100ul |
|
|
HPA060121-100ul |
|
|
HPA060121-100ul |
Produktgarantie und fachkundiger Support
