Anti-DNAJC18

Artikelnummer: ATA-HPA060154
Artikelname: Anti-DNAJC18
Artikelnummer: ATA-HPA060154
Hersteller Artikelnummer: HPA060154
Alternativnummer: ATA-HPA060154-100,ATA-HPA060154-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MGC29463
DnaJ (Hsp40) homolog, subfamily C, member 18
Anti-DNAJC18
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 202052
UniProt: Q9H819
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC18
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to cell junctions.
HPA060154-100ul