Anti-ACOT2
Artikelnummer:
ATA-HPA060170
- Bilder (8)
| Artikelname: | Anti-ACOT2 |
| Artikelnummer: | ATA-HPA060170 |
| Hersteller Artikelnummer: | HPA060170 |
| Alternativnummer: | ATA-HPA060170-100,ATA-HPA060170-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Mte1, ZAP128 |
| acyl-CoA thioesterase 2 |
| Anti-ACOT2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10965 |
| UniProt: | P49753 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ACOT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human kidney and skin tissues using Anti-ACOT2 antibody. Corresponding ACOT2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
HPA060170-100ul |
|
|
|
|
|
HPA060170-100ul |
|
|
HPA060170-100ul |
Produktgarantie und fachkundiger Support
