Anti-RPGRIP1
Artikelnummer:
ATA-HPA060190
- Bilder (7)
| Artikelname: | Anti-RPGRIP1 |
| Artikelnummer: | ATA-HPA060190 |
| Hersteller Artikelnummer: | HPA060190 |
| Alternativnummer: | ATA-HPA060190-100,ATA-HPA060190-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CORD13, LCA6, RGI1, RPGRIP |
| retinitis pigmentosa GTPase regulator interacting protein 1 |
| Anti-RPGRIP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 57096 |
| UniProt: | Q96KN7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YVEYKFYDLPLSETETPVSLRKPRAGEEIHFHFSKVIDLDPQEQQGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQAAAVLHAIYKEMTEDL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RPGRIP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-RPGRIP1 antibody. Corresponding RPGRIP1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human retina shows strong cytoplasmic positivity in photoreceptor cell segments and in subsets of nerve fibers. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA060190-100ul |
|
|
HPA060190-100ul |
|
|
HPA060190-100ul |
Produktgarantie und fachkundiger Support
