Anti-TMEM145
Artikelnummer:
ATA-HPA060462
- Bilder (9)
| Artikelname: | Anti-TMEM145 |
| Artikelnummer: | ATA-HPA060462 |
| Hersteller Artikelnummer: | HPA060462 |
| Alternativnummer: | ATA-HPA060462-100,ATA-HPA060462-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ90805 |
| transmembrane protein 145 |
| Anti-TMEM145 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 284339 |
| UniProt: | Q8NBT3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MTRPSAANKNFPYHVRTSQIASAGVPGPGGSQSADKAFPQHVYGNVTFISDS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TMEM145 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles. |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-TMEM145 antibody. Corresponding TMEM145 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in a subset of neurons. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA060462-100ul |
|
|
|
|
|
HPA060462-100ul |
|
|
HPA060462-100ul |
Produktgarantie und fachkundiger Support
