Anti-CHD2
Artikelnummer:
ATA-HPA060744
- Bilder (8)
| Artikelname: | Anti-CHD2 |
| Artikelnummer: | ATA-HPA060744 |
| Hersteller Artikelnummer: | HPA060744 |
| Alternativnummer: | ATA-HPA060744-100,ATA-HPA060744-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp547I1315, DKFZp686E01200, DKFZp781D1727, FLJ38614 |
| chromodomain helicase DNA binding protein 2 |
| Anti-CHD2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1106 |
| UniProt: | O14647 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QHWYKDHHYGDRRHMDAHRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQDFRRMS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |








