Anti-RRS1
Artikelnummer:
ATA-HPA060937
- Bilder (7)
| Artikelname: | Anti-RRS1 |
| Artikelnummer: | ATA-HPA060937 |
| Hersteller Artikelnummer: | HPA060937 |
| Alternativnummer: | ATA-HPA060937-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0112 |
| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) |
| Anti-RRS1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23212 |
| UniProt: | Q15050 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RRS1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli. |
|
|
Immunohistochemical staining of human pancreas shows moderate nucleolar positivity in exocrine glandular cells. |
|
|
Western blot analysis in human cell lines PC-3 and HeLa using Anti-RRS1 antibody. Corresponding RRS1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis using Anti-RRS1 antibody HPA060937 (A) shows similar pattern to independent antibody HPA055549 (B). |
|
|
HPA060937-100ul |
|
|
HPA060937-100ul |
|
|
HPA060937-100ul |
Produktgarantie und fachkundiger Support
