Anti-DNAH12
Artikelnummer:
ATA-HPA061365
- Bilder (6)
| Artikelname: | Anti-DNAH12 |
| Artikelnummer: | ATA-HPA061365 |
| Hersteller Artikelnummer: | HPA061365 |
| Alternativnummer: | ATA-HPA061365-100,ATA-HPA061365-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19 |
| dynein, axonemal, heavy chain 12 |
| Anti-DNAH12 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 201625 |
| UniProt: | Q6ZR08 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAH12 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DNAH12 antibody. Corresponding DNAH12 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA061365-100ul |
|
|
HPA061365-100ul |
|
|
HPA061365-100ul |
Produktgarantie und fachkundiger Support
