Anti-PRL

Artikelnummer: ATA-HPA062017
Artikelname: Anti-PRL
Artikelnummer: ATA-HPA062017
Hersteller Artikelnummer: HPA062017
Alternativnummer: ATA-HPA062017-100,ATA-HPA062017-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PRL
prolactin
Anti-PRL
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 5617
UniProt: P01236
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PRL
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000
Immunohistochemical staining of human cerebral cortex, liver, lymph node and pituitary gland using Anti-PRL antibody HPA062017 (A) shows similar protein distribution across tissues to independent antibody HPA042416 (B).
Immunohistochemical staining of human lymph node using Anti-PRL antibody HPA062017.
Immunohistochemical staining of human liver using Anti-PRL antibody HPA062017.
Immunohistochemical staining of human pituitary gland using Anti-PRL antibody HPA062017.
Immunohistochemical staining of human cerebral cortex using Anti-PRL antibody HPA062017.
HPA062017-100ul
HPA062017-100ul
HPA062017-100ul