Anti-BTLA
Artikelnummer:
ATA-HPA062029
- Bilder (8)
| Artikelname: | Anti-BTLA |
| Artikelnummer: | ATA-HPA062029 |
| Hersteller Artikelnummer: | HPA062029 |
| Alternativnummer: | ATA-HPA062029-100,ATA-HPA062029-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BTLA1, CD272 |
| B and T lymphocyte associated |
| Anti-BTLA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 151888 |
| UniProt: | Q7Z6A9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BTLA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA062029 antibody. Corresponding BTLA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows moderate positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human small intestine shows moderate positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected. |
|
|
HPA062029-100ul |
|
|
HPA062029-100ul |
|
|
HPA062029-100ul |
Produktgarantie und fachkundiger Support
