Anti-C2orf70
Artikelnummer:
ATA-HPA062453
- Bilder (8)
| Artikelname: | Anti-C2orf70 |
| Artikelnummer: | ATA-HPA062453 |
| Hersteller Artikelnummer: | HPA062453 |
| Alternativnummer: | ATA-HPA062453-100,ATA-HPA062453-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LOC339778 |
| chromosome 2 open reading frame 70 |
| Anti-C2orf70 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 339778 |
| UniProt: | A6NJV1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SAGTLLTEFNAAYVPPGLMPGYQGHVPTVAFSFGAPYGTTTLKYFQDHRNRAMEKSHTPFSQGG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C2orf70 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane & vesicles. |
|
|
Immunohistochemistry analysis in human testis and prostate tissues using Anti-C2orf70 antibody. Corresponding C2orf70 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA062453-100ul |
|
|
|
|
|
HPA062453-100ul |
|
|
HPA062453-100ul |
Produktgarantie und fachkundiger Support
