Anti-BFSP2

Artikelnummer: ATA-HPA062959
Artikelname: Anti-BFSP2
Artikelnummer: ATA-HPA062959
Hersteller Artikelnummer: HPA062959
Alternativnummer: ATA-HPA062959-100,ATA-HPA062959-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CP47, CP49, LIFL-L, phakinin
beaded filament structural protein 2, phakinin
Anti-BFSP2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 8419
UniProt: Q13515
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BFSP2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human cerebral cortex, eye, kidney and liver using Anti-BFSP2 antibody HPA062959 (A) shows similar protein distribution across tissues to independent antibody HPA038464 (B).
Immunohistochemical staining of human kidney using Anti-BFSP2 antibody HPA062959.
Immunohistochemical staining of human cerebral cortex using Anti-BFSP2 antibody HPA062959.
Immunohistochemical staining of human eye using Anti-BFSP2 antibody HPA062959.
Immunohistochemical staining of human liver using Anti-BFSP2 antibody HPA062959.
HPA062959-100ul
HPA062959-100ul
HPA062959-100ul