Anti-ELAVL2
Artikelnummer:
ATA-HPA063001
- Bilder (8)
| Artikelname: | Anti-ELAVL2 |
| Artikelnummer: | ATA-HPA063001 |
| Hersteller Artikelnummer: | HPA063001 |
| Alternativnummer: | ATA-HPA063001-100,ATA-HPA063001-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HEL-N1, HuB |
| ELAV like neuron-specific RNA binding protein 2 |
| Anti-ELAVL2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1993 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ELAVL2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA063001 antibody. Corresponding ELAVL2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA063001-100ul |
|
|
|
|
|
HPA063001-100ul |
|
|
HPA063001-100ul |
Produktgarantie und fachkundiger Support
